The site is undergoing maintenance on
Thursday, September 10, 9:00 pm through Friday, September 11, 9:00 pm (BRT), 2026.
If you encounter problems while ordering, please contact us at BDBCustomerService@bd.com
See More
The site is undergoing maintenance on
Thursday, September 10, 9:00 pm through Friday, September 11, 9:00 pm (BRT), 2026.
If you encounter problems while ordering, please contact us at BDBCustomerService@bd.com
See MoreThe site is undergoing maintenance on
Thursday, September 10, 9:00 pm through Friday, September 11, 9:00 pm (BRT), 2026
.If you encounter problems while ordering, please contact us at BDBCustomerService@bd.com
Looks like you're visiting us from {countryName}.
Would you like to stay on the current country site or be switched to your country?
Understanding the intricacies of the immune system is crucial to elucidating roles of immune cells in health and disease. This requires profiling T- and B-cell receptors (TCRs and BCRs), key determinants of adaptive immunity. The next generation of BD Rhapsody™ TCR/BCR Multiomic Assays reveal immune repertoire richness with great sensitivity alongside simultaneous single-cell gene and protein expression analyses.
Validated on our new Enhanced Cell Capture Beads V3, BD Rhapsody™ TCR/BCR Next Multiomic Assays enable a highly sensitive analysis of full-length TCR/BCR repertoires with robust workflows for human and mouse. Key features include:
Learn more from the BD Rhapsody™ TCR/BCR Next Multiomic Assay Brochure.
In this study, we simultaneously analyzed TCR, BCR, whole transcriptome gene expression as well as cell surface proteins using the BD® AbSeq Immune Discovery Panel in primary PBMCs. In total, 2,380 complete phenotypes were detected from 6,798 putative cells (out of 7,292 input cells).
Using both protein and gene expression, a UMAP plot was generated, and protein markers were used to identify cell populations.
An unsupervised analysis (phenograph) was performed on CD8+ cells where 11 clusters were identified.
Frequencies of unique clonotypes within CD8+ were reported.
The top 5 clonotypes were overlaid on the UMAP plot and identified within phenograph clusters.
Using WTA and AbSeq information, differential gene and protein expression analysis of cells with the most frequent clonotype vs the rest of the population were performed.
Cell IDs and chain information were obtained from the pipeline output files and VDJ and C gene information were determined for the clonotype of interest.
| Cell Index | TCR Alpha Gamma V gene dominant | TCR Alpha Gamma J gene dominant | TCR Alpha Gamma CDR3 translation dominant | TCR Beta Delta V gene dominant | TCR Beta Delta D gene dominant | TCR Beta Delta J gene dominant | TCR Beta Delta C gene dominant | TCR Beta Delta CDR3 translation dominant | TCR Paired Chains | Cell type experimental | High quality cell |
|---|---|---|---|---|---|---|---|---|---|---|---|
| 236563 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
| 638393 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
| 1789392 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
| 2461787 | TRAV41*01 | TRAJ49*01 | AVRSGGDTGNQFY | TRBV5‑6*01 | TRBD2*02 | TRBJ2‑1*01 | TRBC2 | ASSLREYNEQF | TRUE | T_CD8_naive | TRUE |
Full-length sequence of the clonotype was obtained (nucleotide sequence also available) from the pipeline output.
| Cell Index | VDJ Translation Trimmed |
|---|---|
| 236563 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
| 236563 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
| 638393 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
| 638393 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
| 1789392 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
| 1789392 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
| 2461787 | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
| 2461787 | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
| TCR_alpha | KNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHPGGGIVSLFMLSSGK KKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSGGDTGNQFYFGTGTSLTVIP |
| TCR_beta | DAGVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSLREYNEQFFGPGTRLTVL |
For Research Use Only. Not for use in diagnostic or therapeutic procedures.