Skip to main content Skip to navigation
Purified Mouse Anti-Phospholipase Cβ4
Purified Mouse Anti-Phospholipase Cβ4

Western blot analysis of Phospholipase Cβ4. Lysates from PC12 cells (Rat neuroblastoma; ATCC CRL-1721) (10 µg/lane), S2 cells (15 µg/lane), and 0-12 hour Drosophila embryos (15 µg/lane) were probed with the mouse anti-Phospholipase Cβ4 antibody at concentrations of 1.0 µg/ml (lane 1), 0.5 µg/ml (lane 2), and 0.25 µg/ml (lane 3). This antibody detects a band of 130 kDa in all lysates.

Western blot analysis of Phospholipase Cβ4. Lysates from PC12 cells (Rat neuroblastoma; ATCC CRL-1721) (10 µg/lane), S2 cells (15 µg/lane), and 0-12 hour Drosophila embryos (15 µg/lane) were probed with the mouse anti-Phospholipase Cβ4 antibody at concentrations of 1.0 µg/ml (lane 1), 0.5 µg/ml (lane 2), and 0.25 µg/ml (lane 3). This antibody detects a band of 130 kDa in all lysates.

Product Details
Down Arrow Up Arrow


BD Transduction Laboratories™
PLCβ4
Fly (QC Testing), Human, Mouse, Rat (Tested in Development)
Mouse IgG1
Human Phospholipase Cβ4 aa. 752-961
Western blot (Routinely Tested), Immunofluorescence (Tested During Development)
130 kDa
250 µg/ml
AB_399683
Aqueous buffered solution containing BSA, glycerol, and ≤0.09% sodium azide.
RUO


Preparation And Storage

The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. Store undiluted at -20°C.

Recommended Assay Procedures

Western blot:  Please refer to http://www.bdbiosciences.com/pharmingen/protocols/Western_Blotting.shtml

The Drosophila melanogaster gene, no receptor potential A (abbreviated as norpA), encodes a 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase involved in calcium-mediated signaling, which is a component of the membrane fraction. Its amino acid sequence contains a phosphatidylinositol-specific phospholipase C (X domain), a phosphoinositide-specific phospholipase C (PLC) and a phosphatidylinositol-specific phospholipase C (Y domain). Similar sequences have been identified in C. elegans, Homo sapiens, Mus musculus, Rattus norvegicus, and Saccharomyces cerevisiae. It has been mapped by recombination to 1-6.5 and cytologically to 4C1. [FGgn0004625] (The FlyBase Consortium (http://flybase.org/) )

>gi|26007014|sp|P13217|PIPA_DROME 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase(Phosphoinositide-specific phospholipase C)(No receptor potential A protein)  Length = 1095

Score  = 91.4 bits    (208),   Expect = 7e-19

Identities  = 73/216    (33%),   Positives =  116/216  (53%),  Gaps = 57/216   (26%)

Query: 1      EAKKGIE--LI--PQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ-           55

              E KK  E  L+  P V +E L+Q K+  K  KKQ KEL++L+KKHAKE +++QK   TQ

Sbjct: 859    EEKK--EPPLVFEP-VTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQK---TQN           912

Query: 56     --VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVA           113

                +DK++    K KS                      K+ +I+     +D +  +K  +

Sbjct: 913    AAIDKLI----KGKS----------------------KD-DIR-----ND--ANIKNSIN           938

Query: 114    QHTKEWSEMINTHSAEE-----QEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRES           168

                TK+W++MI  H  EE     Q ++D   SQ  + +K L++     Q +QL+  H R+

Sbjct: 939    DQTKQWTDMIARHRKEEWDMLRQHVQD---SQ--DAMKALMLTVQAAQIKQLEDRHARDI           993

Query: 169    KEMRAHQAKISMENSKAISQDKSIKNKAERERRVRE                                   204

              K++ A QAK+S + +K +  DK++K K E++RR+RE

Sbjct: 994    KDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLRE                                   1029

Product Notices

  1. Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  2. Please refer to www.bdbiosciences.com/us/s/resources for technical protocols.
  3. Caution: Sodium azide yields highly toxic hydrazoic acid under acidic conditions. Dilute azide compounds in running water before discarding to avoid accumulation of potentially explosive deposits in plumbing.
  4. Source of all serum proteins is from USDA inspected abattoirs located in the United States.
612646 Rev. 1
Antibody Details
Down Arrow Up Arrow
56/Phospholipase Cβ4

Phospholipase C (PLC) hydrolyzes inositol phospholipids into diacylglycerol and inositol 1,4,5-trisphosphate (IP3). Multiple distinct PLC isoenzymes have been identified and divided into three structural types: α, β, and γ. This classification is based primarily on the location of the conserved X and Y domains, whose structural integrity is essential for a functional catalytic core. The activation of PLCβ isoenzymes is uniquely regulated by G protein subunits, while PLCγ is activated following phosphorylation by protein tyrosine kinases. The β subfamily of PLC consists of at least four members: β1, β2, β3, and β4. PLCβ4 differs from the other members in that it is not activated by G protein βγ subunits, it is not found in the liver or kidney, and it is inhibited by ribonucleotides. Various isoforms of PLβC4 result from alternative splicing or proteolytic cleavage. PLCβ4 is expressed in retina and brain and knockout mice display ataxia and abnormalities in metabotropic glutamate receptor function in the cerebellum. Thus, PLCβ4 is primarily found in neuronal tissues where it is thought to be important in neurotransmitter signaling pathways.

612646 Rev. 1
Format Details
Down Arrow Up Arrow
Purified
Tissue culture supernatant is purified by either protein A/G or affinity purification methods. Both methods yield antibody in solution that is free of most other soluble proteins, lipids, etc. This format provides pure antibody that is suitable for a number of downstream applications including: secondary labeling for flow cytometry or microscopy, ELISA, Western blot, etc.
Purified
612646 Rev.1
Citations & References
Down Arrow Up Arrow

Development References (4)

  1. Alvarez RA, Ghalayini AJ, Xu P. cDNA sequence and gene locus of the human retinal phosphoinositide-specific phospholipase-C beta 4 (PLCB4). Genomics. 1995; 29(1):53-61. (Biology). View Reference
  2. Kano M, Hashimoto K, Watanabe M. Phospholipase cbeta4 is specifically involved in climbing fiber synapse elimination in the developing cerebellum. Proc Natl Acad Sci U S A. 1998; 95(26):15724-15729. (Biology). View Reference
  3. Kim D, Jun KS, Lee SB. Phospholipase C isozymes selectively couple to specific neurotransmitter receptors. Nature. 1997; 389(6648):290-293. (Biology). View Reference
  4. Lee CW, Park DJ, Lee KH, Kim CG, Rhee SG. Purification, molecular cloning, and sequencing of phospholipase C-beta 4. J Biol Chem. 1993; 268(28):21318-21327. (Biology). View Reference
View All (4) View Less
612646 Rev. 1

Please refer to Support Documents for Quality Certificates


Global - Refer to manufacturer's instructions for use and related User Manuals and Technical data sheets before using this products as described


Comparisons, where applicable, are made against older BD Technology, manual methods or are general performance claims.  Comparisons are not made against non-BD technologies, unless otherwise noted.

For Research Use Only. Not for use in diagnostic or therapeutic procedures.