Skip to main content Skip to navigation
Purified Mouse Anti-Endothelin 1 Receptor
Purified Mouse Anti-Endothelin 1 Receptor
Western blot analysis of Endothelin Receptor-1. Lysates from rat testis (5 µg/lane), S2 cells (7.5 µg/lane), 0-12 hours Drosophila embryos (7.5 µg/lane) were probed with the mouse anti-endothelin receptor 1 antibody at concentrations of 0.5 µg/ml (lane 1), 0.25 µg/ml (lane 2), and 0.125 µg/ml (lane 3). Endothelin Receptor-1 is detectable at 50-66 kDa.
Western blot analysis of Endothelin Receptor-1. Lysates from rat testis (5 µg/lane), S2 cells (7.5 µg/lane), 0-12 hours Drosophila embryos (7.5 µg/lane) were probed with the mouse anti-endothelin receptor 1 antibody at concentrations of 0.5 µg/ml (lane 1), 0.25 µg/ml (lane 2), and 0.125 µg/ml (lane 3). Endothelin Receptor-1 is detectable at 50-66 kDa.
Product Details
Down Arrow Up Arrow


BD Transduction Laboratories™
Fly (QC Testing), Human, Mouse, Rat (Tested in Development)
Mouse IgG1
Rat Endothelin 1 Receptor aa. 230-352
Western blot (Routinely Tested)
50-66 kDa
250 µg/ml
AB_399666
Aqueous buffered solution containing BSA, glycerol, and ≤0.09% sodium azide.
RUO


Preparation And Storage

The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. Store undiluted at -20°C.

Recommended Assay Procedures

Western blot:  Please refer to http://www.bdbiosciences.com/pharmingen/protocols/Western_Blotting.shtml

The Drosophila melanogaster gene CG18192 encodes a putative neuropeptide receptor involved in the G-protein coupled receptor protein signaling pathway, which is a component of the integral membrane protein. Its amino acid sequence contains rhodopsin-like, GPCR superfamily and bombesin receptor domains. Similar sequences have been identified in Homo sapiens, Mus musculus and Rattus. It has been mapped cytologically to 54D3. [FBgn0050106] (The FlyBase Consortium (http://flybase.org/)).

>gb|AAF57820.1| (AE003802) CG18192 gene product [Drosophila melanogaster] Length = 524

Score = 46.6 bits (109), Expect = 2e-06

Identities = 24/67 (35%), Positives = 41/67 (60%), Gaps = 3/67 (4%)

Query: 31  FGFYFCMPLVCTAIFYTLMTCEMLNRRN--GSLRIALSEHLKQRREVAKTVFCLVVIFAL 88

           F  Y+ +PLV  A+FY L+   ++   +  G ++ A+ + ++ RR+VA TV   VVIF +

Sbjct: 146 FLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQ-VRARRKVAVTVLAFVVIFGI 204

Query: 89  CWFPLHL 95

           C+ P H+

Sbjct: 205 CFLPYHV 211

Product Notices

  1. Since applications vary, each investigator should titrate the reagent to obtain optimal results.
  2. Please refer to www.bdbiosciences.com/us/s/resources for technical protocols.
  3. Caution: Sodium azide yields highly toxic hydrazoic acid under acidic conditions. Dilute azide compounds in running water before discarding to avoid accumulation of potentially explosive deposits in plumbing.
  4. Source of all serum proteins is from USDA inspected abattoirs located in the United States.
612629 Rev. 1
Antibody Details
Down Arrow Up Arrow
16/Endothelin 1 Receptor

Endothelin-1 (ET-1) is a potent vasoconstrictor that is secreted by vascular endothelial cells.  ET-1, ET-2, ET-3, and endothelin β are members of a family of related peptides.  All are 21 amino acid peptides with two disulfide bridges.  ET-1 and ET-2 differ by only two residues, while ET-3 differs from both by six residues.  ET-1 and ET-2 are highly effective on vascular smooth muscle, while the effects of ET-3 are minimal.  ET-1 and its precursor, big ET-1, are the primary forms present in the circulation.  Circulating ET-1 plays a pathologic role in the etiology of hypertension and antagonists are utilized in the treatment of this disease.  The ET-1 receptor is a seven-transmembrane-domain receptor of the G-protein-coupled family that signals via transient increases in intracellular Ca2+.  It is primarily expressed in lung and heart and is detected at lower levels in liver, brain, muscle, and kidney.  ET-1 receptor interacts with ET-1, ET-2, and ET-3.  However, it has a 2-3 fold higher affinity for ET-1 than ET-2 and the affinity for ET-3 is more than 100 fold lower.  Thus, ligation of the ET-1 receptor by ET-1 induces increased intracellular Ca2+ that signals to promote vasoconstriction.

This antibody is routinely tested by western blot analysis. Other applications were tested at BD Biosciences Pharmingen during antibody development only or reported in the literature.

612629 Rev. 1
Format Details
Down Arrow Up Arrow
Purified
Tissue culture supernatant is purified by either protein A/G or affinity purification methods. Both methods yield antibody in solution that is free of most other soluble proteins, lipids, etc. This format provides pure antibody that is suitable for a number of downstream applications including: secondary labeling for flow cytometry or microscopy, ELISA, Western blot, etc.
Purified
612629 Rev.1
Citations & References
Down Arrow Up Arrow

Development References (2)

  1. Lin HY, Kaji EH, Winkel GK, Ives HE, Lodish HF. Cloning and functional expression of a vascular smooth muscle endothelin 1 receptor. Proc Natl Acad Sci U S A. 1991; 88(8):3185-3189. (Biology). View Reference
  2. Masuda Y, Miyazaki H, Kondoh M, et al. Two different forms of endothelin receptors in rat lung. FEBS Lett. 1989; 257(2):208-210. (Biology). View Reference
612629 Rev. 1

Please refer to Support Documents for Quality Certificates


Global - Refer to manufacturer's instructions for use and related User Manuals and Technical data sheets before using this products as described


Comparisons, where applicable, are made against older BD Technology, manual methods or are general performance claims.  Comparisons are not made against non-BD technologies, unless otherwise noted.

For Research Use Only. Not for use in diagnostic or therapeutic procedures.